PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010099155.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family TALE
Protein Properties Length: 395aa    MW: 44537.9 Da    PI: 6.9598
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010099155.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.62.5e-093223562155
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                     k +yps++++  LA+++gL+++q+ +WF N+R ++
  XP_010099155.1 322 KWPYPSESQKLALAESTGLDQKQINNWFINQRKRH 356
                     569*****************************885 PP

2ELK414.1e-14276297122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELK qLlrKYsgyLgsLkqEF+
  XP_010099155.1 276 ELKGQLLRKYSGYLGSLKQEFM 297
                     9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.1E-19139183IPR005540KNOX1
PfamPF037901.0E-21142179IPR005540KNOX1
SMARTSM012561.2E-25189240IPR005541KNOX2
PfamPF037919.0E-21193239IPR005541KNOX2
PROSITE profilePS5121311.174276296IPR005539ELK domain
SMARTSM011882.8E-8276297IPR005539ELK domain
PfamPF037896.7E-11276297IPR005539ELK domain
PROSITE profilePS5007112.989296359IPR001356Homeobox domain
SuperFamilySSF466891.97E-19298374IPR009057Homeodomain-like
SMARTSM003897.4E-13298363IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.1E-28301361IPR009057Homeodomain-like
CDDcd000863.08E-12308360No hitNo description
PfamPF059207.3E-17316355IPR008422Homeobox KN domain
PROSITE patternPS000270334357IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009934Biological Processregulation of meristem structural organization
GO:0048440Biological Processcarpel development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 395 aa     Download sequence    Send to blast
MEGGSNGTSC MMAFGENSNG LCPMMMMPLM TSHHSHHAHH HHHHHHQQQQ QQQQHHNHHP  60
INPNNPNANA DTNNIAPLFL PFPLPAPTNI NHQNRHSSNT SGSSSSFNIM LDHNNNNTSA  120
TAGSTYFMAG QNNDCNNISS FKAKIMAHPH YHRLLAAYVN CQKVGAPVEV VARLEEACAT  180
AAAAMGHVST GSLGEDPALD QFMEAYCEML TKYEQELSKP FKEAMLFLQS IECQFKTLTL  240
SSSDSGCGEA VDRNGSSEEE VDVNNSLIDP QAEDRELKGQ LLRKYSGYLG SLKQEFMKKR  300
KKGKLPKEAR QQLLDWWSRH YKWPYPSESQ KLALAESTGL DQKQINNWFI NQRKRHWKPS  360
EDMQFVVMDA THPHHYYMDN VLGNPFPMDI SPALL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1291300LKQEFMKKRK
2297301KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010099155.10.0Homeobox protein
SwissprotP466081e-155HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLW9RHD80.0W9RHD8_9R
STRINGVIT_10s0116g00190.t011e-165(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-143KNOX/ELK homeobox transcription factor